Your Cart

15% off everything this weekend · code WEEKEND15 at the checkout · ends midnight Sunday15% off this weekend · code WEEKEND15 · ends Sunday

Thymosin Beta 4 5mg TB500

Research Handling Note:

Allow sealed vials to reach ambient laboratory temperature before opening, to prevent condensation forming inside the vial. Store sealed vials at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

Thymosin Beta 4 5mg TB500
Selling fast
Thymosin Beta 4 5mg TB500
from
£33.00
5 or more £32.50
25 or more £30.50
50 or more £27.00
  • Stock: 1088
  • Model: 5mg TB500
  • Molecular Formula: C212H350N56O78S - 5mg
  • SKU: TB5-022
  • Research Only: Yes
Products Sold: 109118
Product Views: 255766

Certificate of analysis

PDF COA

TB-500 5mg - High-Quality Research Peptide

TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: TB-500 5mg
  • Catalogue Number: TB500-5mg
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity: ≥98%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid

Storage and Handling:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Identification
Molecular Weight (g/mol)4963.44 g/mol
Peptide SequenceAc-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Physical and Chemical Properties
Molecular FormulaC212H350N56O78S
Physical AppearanceWhite lyophilised solid
FormSterile filtered white lyophilized (freeze-dried)
SolubilityAqueous soluble
AppearanceWhite to off-white lyophilised powder
Melting PointNot applicable (decomposes before melting)
Analytical and Quality Control
HPLC ResultShows min 98% purity
Mass SpectrumConsistent with structure
Purity %>98%
Research Use and Safety
CautionResearch use only / Not for human or veterinary use
Intended UseFor laboratory research use only. Not for human or veterinary use.
Hazard ClassificationNot classified as hazardous under GHS for research quantities
Storage, Handling and Stability
Storage Temperature, OpenedLyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.
Storage Temperature, Unopened-20 °C recommended for long-term storage
Shelf Life2 years unopened under recommended conditions
Reconstitution StabilityStable for up to 28 days at 2-8 °C in aqueous solution under sterile conditions