TB-500 2mg - High-Quality Research Peptide

TB-500, offered at 2mg, is a high-quality specialised research peptide developed for advanced scientific exploration in tissue repair, inflammation reduction, and cellular regeneration. This product is ideal for laboratory settings where precision and reliability are paramount.

Product Name: TB-500 2mg
Catalogue Number: TB500-2mg
Molecular Formula: C212H350N56O78S
Molecular Weight: 4963.4 g/mol
Purity: ≥98%
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Form: Lyophilised Solid

Usage and Storage:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Physical and chemical properties
Molecular Formula	C212H350N56O78S
Molecular Weight	4963.44
Physical Appearance	White lyophilised solid
Purity	>98%
Peptide Sequence	Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Form & Formulations	Sterile filtered white lyophilized (freeze-dried)
Solubility	Aqueous soluble
Storage	Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.
Analytical Data
HPLC	Shows min 98% purity
Mass Spectrum	Consistent with structure
Research use
Caution	Research use only / Not for human or veterinary use