Your Cart
🎉 Get 10% off your next order — use coupon code  "SPECIAL" at checkout!

Thymosin Beta 4 5mg TB500

Important Note:

Ensure the peptide and mixing solution are at room temperature before reconstitution to prevent temperature shock and aid proper dissolution. Avoid excessive dilution, as some peptides degrade more quickly in solution. *Reconstitution solution sold separately.

Thymosin Beta 4 5mg TB500
Selling fast
Thymosin Beta 4 5mg TB500
from
£33.00
5 or more £32.50
25 or more £30.50
50 or more £27.00
  • Stock: 473
  • Model: 5mg TB500
  • Molecular Formula: C212H350N56O78S - 5mg
  • SKU: TB5-022
  • Research Only: Yes
Products Sold: 75524
Product Views: 153921

Certificate of analysis

PDF COA

TB-500 5mg - High-Quality Research Peptide

TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: TB-500 5mg
  • Catalogue Number: TB500-5mg
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity: ≥98%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid

Usage and Storage:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Physical and chemical properties
Molecular FormulaC212H350N56O78S
Molecular Weight4963.44
Physical AppearanceWhite lyophilised solid
Purity>98%
Peptide SequenceAc-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Form & FormulationsSterile filtered white lyophilized (freeze-dried)
SolubilityAqueous soluble
StorageLyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.
Analytical Data
HPLCShows min 98% purity
Mass SpectrumConsistent with structure
Research use
CautionResearch use only / Not for human or veterinary use

We do not accept reviews as these products are for research use only