
- Stock: 14228
- Model: 5mg TB500
- Molecular Formula: C212H350N56O78S - 5mg
- SKU: TB5-022
- Research Only: Yes
Certificate of analysis

TB-500 5mg - High-Quality Research Peptide
TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are paramount.
- Product Name: TB-500 5mg
- Catalogue Number: TB500-5mg
- Molecular Formula: C212H350N56O78S
- Molecular Weight: 4963.4 g/mol
- Purity: ≥98%
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Form: Lyophilised Solid
Usage and Storage:
TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.
Synthesis and Quality Assurance:
TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Legal and Safety Information:
UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.
If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.
Identification | |
Molecular Weight (g/mol) | 4963.44 |
Peptide Sequence | Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH |
Physical and Chemical Properties | |
Molecular Formula | C212H350N56O78S |
Physical Appearance | White lyophilised solid |
Form | Sterile filtered white lyophilized (freeze-dried) |
Solubility | Aqueous soluble |
Analytical and Quality Control | |
HPLC Result | Shows min 98% purity |
Mass Spectrum | Consistent with structure |
Purity % | >98% |
Research Use and Safety | |
Caution | Research use only / Not for human or veterinary use |
Storage, Handling and Stability | |
Storage Temperature, Opened | Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C. |