Your Cart

Celebrating 15 years — 25% off everything  ·  code 25LOYALTY

LL-37 5mg

Research Handling Note:

Allow sealed vials to reach ambient laboratory temperature before opening, to prevent condensation forming inside the vial. Store sealed vials at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

LL-37 5mg
LL-37 5mg
from
£69.00
5 or more £67.00
10 or more £65.00
25 or more £60.00
  • Stock: 190
  • Model: LL-37 5mg
  • Molecular Formula: C205H340N60O53
Products Sold: 596
Product Views: 27639

Certificate of analysis

PDF COA

LL-37 5mg - High-Quality Research Peptide

LL-37, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in immunology and microbiology. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: LL-37 5mg
  • Catalogue Number: LL37-5mg
  • Molecular Formula: C205H340N60O53
  • Molecular Weight: 4493.3 g/mol
  • Purity: ≥98%
  • Sequence: [LL-37, 37 aa]
  • Form: Lyophilised Solid

Storage and Handling:

LL-37 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

Synthesis and Quality Assurance:

LL-37 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides LL-37 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including LL-37, are not designed for human consumption or clinical application.

If you require high-quality LL-37 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Identification
Molecular Weight (g/mol)4493.37 g/mol
Peptide SequenceLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
CAS Number154947-66-7
Physical and Chemical Properties
Molecular FormulaC205H340N60O53
AppearanceWhite to off-white lyophilised powder
Melting PointNot applicable (decomposes before melting)
Research Use and Safety
CautionHandle using appropriate PPE and in compliance with relevant laboratory safety standards.
Intended UseFor laboratory research use only. Not for human or veterinary use.
Hazard ClassificationNot classified as hazardous under GHS for research quantities
Storage, Handling and Stability
Storage Temperature, Opened-20 °C, minimise freeze-thaw cycles
Storage Temperature, Unopened-20 °C recommended for long-term storage
Shelf Life2 years unopened under recommended conditions
Reconstitution StabilityStable for up to 28 days at 2-8 °C in aqueous solution under sterile conditions