Your Cart
🎉 Get 10% off your next order — use coupon code  "SPECIAL" at checkout!

TB500 + BPC157 Bundle

5x
BPC-157 5mg
BPC-157 5mg
£16.95
+
Bundle price: £161.03
You save £8.48!

Add bundle to Cart

5 x BPC 5mg Vials

5 x TB500 2mg Vials

BPC-157 5mg - Research Peptide

BPC157, offered at 5mg, is a unique, specialised research peptide developed for advanced scientific exploration in tissue. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: BPC-157 5mg
  • Catalogue Number: BPC5-024
  • Molecular Formula: C62H98N16O22
  • Molecular Weight: 1479.6 g/mol
  • Purity: 99%
  • Sequence: H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH
  • Form: Lyophilised Solid

Usage and Storage:

BPC-157 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

BPC-157 is meticulously synthesised through a controlled process that guarantees high purity and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards that researchers require.

Why Choose UK Peptides for BPC-157 in the UK?

Since 2012, UK Peptides has been a trusted name in the peptide industry. Our reputation for delivering high-purity peptides suitable for research is backed by over a decade of experience. Unlike many other suppliers, we work directly with our trusted manufacturer, ensuring that each batch meets the highest standards for quality and purity. We do not purchase from third-party resellers, which allows us to maintain consistency, reliability, and unmatched product quality in every vial.

Legal and Safety Information:

UK-Peptides proudly provides BPC-157 strictly for scientific and research use. We are dedicated to supporting the research community and ensuring our products meet stringent quality standards and legal requirements. Please note that our peptides, including BPC-157, are not designed for human consumption or clinical application.

If you require high-quality BPC 157 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.


TB-500 2mg - High-Quality Research Peptide

TB-500, offered at 2mg, is a high-quality specialised research peptide developed for advanced scientific exploration in tissue repair, inflammation reduction, and cellular regeneration. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: TB-500 2mg
  • Catalogue Number: TB500-2mg
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity: ≥98%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid

Usage and Storage:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.