Your Cart
Notice 📦 Loading dispatch date...

Thymosin Beta 4 5mg TB500

Research Handling Note:

For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.

Thymosin Beta 4 5mg TB500
Selling fast
Thymosin Beta 4 5mg TB500
from
£33.00
5 or more £32.50
25 or more £30.50
50 or more £27.00
  • Stock: 13048
  • Model: 5mg TB500
  • Molecular Formula: C212H350N56O78S - 5mg
  • SKU: TB5-022
  • Research Only: Yes
Products Sold: 85863
Product Views: 184167

Certificate of analysis

PDF COA

TB-500 5mg - High-Quality Research Peptide

TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular regeneration and tissue repair. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: TB-500 5mg
  • Catalogue Number: TB500-5mg
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity: ≥98%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid

Usage and Storage:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Identification
Molecular Weight (g/mol)4963.44
Peptide SequenceAc-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH
Physical and Chemical Properties
Molecular FormulaC212H350N56O78S
Physical AppearanceWhite lyophilised solid
FormSterile filtered white lyophilized (freeze-dried)
SolubilityAqueous soluble
Analytical and Quality Control
HPLC ResultShows min 98% purity
Mass SpectrumConsistent with structure
Purity %>98%
Research Use and Safety
CautionResearch use only / Not for human or veterinary use
Storage, Handling and Stability
Storage Temperature, OpenedLyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.