
- Stock: 139
- Model: IGF1-LR3 1mg
- Molecular Formula: C400H625N111O115S9
- SKU: IGFLR-022
- Research Only: Yes
Certificate of analysis
IGF LR3 (Long arginine 3-IGF-1) 1mg - High-Quality Research Peptide
Long arginine 3-IGF-1 (IGF-1 LR3), offered at 1mg, is a high-quality specialised research peptide developed for advanced scientific exploration in biochemistry and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.
- Product Name: IGF LR3 1mg
- Catalogue Number: IGF1LR3-1mg
- Molecular Weight: 9117.60 gmol
- Purity: ≥98%
- Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Form: Lyophilised Solid
Usage and Storage:
Long arginine 3-IGF-1 (IGF-1 LR3) is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.
Synthesis and Quality Assurance:
Long arginine 3-IGF-1 (IGF-1 LR3) is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Legal and Safety Information:
UK-Peptides proudly provides Long arginine 3-IGF-1 (IGF-1 LR3) strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Long arginine 3-IGF-1 (IGF-1 LR3), are not designed for human consumption or clinical application.
If you require high-quality Long arginine 3-IGF-1 (IGF-1 LR3) for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.
| Identification | |
| Molecular Weight (g/mol) | 9.1k |
| Physical and Chemical Properties | |
| Physical Appearance | White lyophilised solid |
| Form | Sterile filtered white lyophilized (freeze-dried) |
| Solubility | Aqueous soluble |
| Analytical and Quality Control | |
| HPLC Result | shows min 98% Purity |
| Mass Spectrum | Consistent with structure |
| Purity % | >98% |
| Research Use and Safety | |
| Caution | Research use only / Not for human or veterinary use |
| Storage, Handling and Stability | |
| Storage Temperature, Opened | Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C. |