Your Cart

IGF1-LR3 1mg

Research Handling Note:

Allow sealed vials to reach ambient laboratory temperature before opening, to prevent condensation forming inside the vial. Store sealed vials at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

IGF1-LR3 1mg
Selling fast
IGF1-LR3 1mg
from
£59.00
5 or more £55.00
10 or more £50.00
  • Stock: 477
  • Model: IGF1-LR3 1mg
  • Molecular Formula: C400H625N111O115S9
  • SKU: IGFLR-022
  • Research Only: Yes
Products Sold: 24521
Product Views: 172464

Certificate of analysis

PDF COA

IGF LR3 (Long arginine 3-IGF-1) 1mg - High-Quality Research Peptide

Long arginine 3-IGF-1 (IGF-1 LR3), offered at 1mg, is a high-quality specialised research peptide developed for advanced scientific exploration in biochemistry and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: IGF LR3 1mg
  • Catalogue Number: IGF1LR3-1mg
  • Molecular Formula: C400H625N111O115S9
  • Molecular Weight: 9117.60 g/mol
  • Purity: ≥98%
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Form: Lyophilised Solid

Storage and Handling:

Long arginine 3-IGF-1 (IGF-1 LR3) is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

Synthesis and Quality Assurance:

Long arginine 3-IGF-1 (IGF-1 LR3) is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides Long arginine 3-IGF-1 (IGF-1 LR3) strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Long arginine 3-IGF-1 (IGF-1 LR3), are not designed for human consumption or clinical application.

If you require high-quality Long arginine 3-IGF-1 (IGF-1 LR3) for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Identification
Molecular Weight (g/mol)9117.60 g/mol
Physical and Chemical Properties
Molecular FormulaC400H625N111O115S9
Physical AppearanceWhite lyophilised solid
FormSterile filtered white lyophilized (freeze-dried)
SolubilityAqueous soluble
AppearanceWhite to off-white lyophilised powder
Melting PointNot applicable (decomposes before melting)
Analytical and Quality Control
HPLC Resultshows min 98% Purity
Mass SpectrumConsistent with structure
Purity %>98%
Research Use and Safety
CautionResearch use only / Not for human or veterinary use
Intended UseFor laboratory research use only. Not for human or veterinary use.
Hazard ClassificationNot classified as hazardous under GHS for research quantities
Storage, Handling and Stability
Storage Temperature, OpenedLyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.
Storage Temperature, Unopened-20 °C recommended for long-term storage
Shelf Life2 years unopened under recommended conditions
Reconstitution StabilityStable for up to 28 days at 2-8 °C in aqueous solution under sterile conditions