Your Cart
Notice 📦 Loading dispatch date...

TB500 2mg Bundle 10mg

Bundle price: £84.75
You save £0.00!

Add bundle to Cart

5 x Vials of 2mg TB500

This product is five single vials of 2mg, which equals 10mg

All vials of TB500 will come in a lyophilised, freeze-dried form and require mixing water to reconstitute them. 

TB-500 2mg - High-Quality Research Peptide

TB-500, offered at 2mg, is a high-quality specialised research peptide developed for advanced scientific exploration in tissue repair, inflammation reduction, and cellular regeneration. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: TB-500 2mg
  • Catalogue Number: TB500-2mg
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.4 g/mol
  • Purity: ≥98%
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Form: Lyophilised Solid

Usage and Storage:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.