Your Cart
Holiday Notice: Closed Dec 24-26, 31 & Jan 1 - Orders still open. Dispatch delays expected View Schedule
Loading dispatch date...

Sermorelin (GRF 1-29 ) 5mg

Research Handling Note:

For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.

Sermorelin (GRF 1-29 ) 5mg
Selling fast
Sermorelin (GRF 1-29 ) 5mg
from
£29.00
5 or more £28.00
10 or more £27.00
25 or more £23.50
  • Stock: 2853
  • Model: Sermorelin 5mg
  • Molecular Formula: C149H246N44O42S 5mg
  • Research Only: Yes
Products Sold: 8333
Product Views: 47779

Certificate of analysis

PDF COA

Sermorelin Acetate 5mg - High-Quality Research Peptide

Sermorelin Acetate, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in endocrinology and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: Sermorelin Acetate 5mg
  • Catalogue Number: UKSERM2
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3358.9 g/mol
  • Purity: ≥98%
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (acetate salt)
  • Form: Lyophilised Solid

Usage and Storage:

Sermorelin Acetate is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

Sermorelin Acetate is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides Sermorelin Acetate strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Sermorelin Acetate, are not designed for human consumption or clinical application.

If you require high-quality Sermorelin Acetate for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Identification
Molecular Weight (g/mol)3417.985 g/mol
Physical and Chemical Properties
Molecular FormulaC151H250N44O44S
Physical AppearanceWhite lyophilised solid
Research Use and Safety
CautionResearch use only / Not for human or veterinary use
Storage, Handling and Stability
Storage Temperature, OpenedLyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide, it should be stored at 4°C between 2-21 days and for future use below -18°C.