Your Cart
🎉 Get 10% off your next order — use coupon code  "SPECIAL" at checkout!

IGF1-LR3 1mg

Important Note:

Ensure the peptide and mixing solution are at room temperature before reconstitution to prevent temperature shock and aid proper dissolution. Avoid excessive dilution, as some peptides degrade more quickly in solution. *Reconstitution solution sold separately.

IGF1-LR3 1mg
Selling fast
IGF1-LR3 1mg
from
£59.00
5 or more £55.00
10 or more £50.00
  • Stock: 723
  • Model: IGF1-LR3 1mg
  • Molecular Formula: C400H625N111O115S9
  • SKU: IGFLR-022
  • Research Only: Yes
Products Sold: 20430
Product Views: 117560

Certificate of analysis

PDF COA

IGF LR3 (Long arginine 3-IGF-1) 1mg - High-Quality Research Peptide

Long arginine 3-IGF-1 (IGF-1 LR3), offered at 1mg, is a high-quality specialised research peptide developed for advanced scientific exploration in biochemistry and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: IGF LR3 1mg
  • Catalogue Number: IGF1LR3-1mg
  • Molecular Weight: 9117.60 gmol
  • Purity: ≥98%
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Form: Lyophilised Solid

Usage and Storage:

Long arginine 3-IGF-1 (IGF-1 LR3) is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

Long arginine 3-IGF-1 (IGF-1 LR3) is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides Long arginine 3-IGF-1 (IGF-1 LR3) strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Long arginine 3-IGF-1 (IGF-1 LR3), are not designed for human consumption or clinical application.

If you require high-quality Long arginine 3-IGF-1 (IGF-1 LR3) for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Physical and chemical properties
Molecular Weight9.1k
Physical AppearanceWhite lyophilised solid
Purity>98%
Form & FormulationsSterile filtered white lyophilized (freeze-dried)
SolubilityAqueous soluble
StorageLyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.
Analytical Data
HPLCshows min 98% Purity
Mass SpectrumConsistent with structure
Research use
CautionResearch use only / Not for human or veterinary use

We do not accept reviews as these products are for research use only