Your Cart
🎉 Get 10% off your next order — use coupon code  "SPECIAL" at checkout!

LL-37 5mg

Important Note:

Ensure the peptide and mixing solution are at room temperature before reconstitution to prevent temperature shock and aid proper dissolution. Avoid excessive dilution, as some peptides degrade more quickly in solution. *Reconstitution solution sold separately.

LL-37 5mg
LL-37 5mg
from
£69.00
5 or more £67.00
10 or more £65.00
25 or more £60.00
  • Stock: 223
  • Model: LL-37 5mg
  • Molecular Formula: C205H340N60O53
Products Sold: 333
Product Views: 12674

Certificate of analysis

PDF COA

LL-37 5mg - High-Quality Research Peptide

LL-37, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in immunology and microbiology. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: LL-37 5mg
  • Catalogue Number: LL37-5mg
  • Molecular Formula: C205H340N60O53
  • Molecular Weight: 4493.3 g/mol
  • Purity: ≥98%
  • Sequence: [LL-37, 37 aa]
  • Form: Lyophilised Solid

Usage and Storage:

LL-37 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

LL-37 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides LL-37 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including LL-37, are not designed for human consumption or clinical application.

If you require high-quality LL-37 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

We do not accept reviews as these products are for research use only